Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
Amyloid P Component 33 38 amide 180387 76 2 Adropin 34 76 human mouse rat 1802086 30 1 Arg3 Amyloid β Protein 1 40 1802084 01 0 Arg17 Amyloid β Protein 1 42 1802085 97 7 Ac D Val OH 17916 88 0 Acetyl Amylin 8 37 human 178603 79 7 AC ARG OME HCL 1784 05 0 Activity Dependent Neurotrophic Factor 14 177159 38 5 Ac Gly Arg Gly NH2 176520 14 2 Astressin 170809 51 5 a Conotoxin El Conus ermineus 170663 33 9 ACTH 1 24 human SYSMEHFRWGKPVGKKRRPVKVYP 16960 16 0 Asp370 Tyrosinase 368 376 YMDGTMSQV 168650 46 2 Ac Asp Tyr 2 malonyl Val Pro Met Leu NH2 168135 79 3 Ala9 Autocamtide 2 Autocamtide 2 Related Inhibitory Peptide 167114 91 2 Ala pNA 1668 13 9 Adrenomedullin 11 50 rat STGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY NH2 Disulfidebridge 4 9 163648 32 6 Ac N Me Tyr Val Ala Asp aldehyde pseudo acid 160806 26 8 Ac Leu Val Phe aldehyde 160369 84 6 Adrenomedullin 1 50 rat YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY NH2 Disulfidebridge 14 19 159964 38 2 Adrenomedullin 22 52 human TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY NH2 159899 65 7 Ac Tyr PO3H2 Glu Glu Ile Glu OH 159439 02 8 Ac Nle OH 15891 49 3 Antioxidant peptide A PHCKRM 159147 88 3 Acetyl Leu28·31 Neuropeptide Y 24 36 155709 24 3 Ac Ala Ala Ala Ala OH 15483 58 6 Adrenomedullin 13 52 human SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY NH2 Disulfidebridge 4 9 154765 05 6 Acetalin 1 Opioid Receptor Antagonist 1 Ac RFMWMR NH2 152274 65 2 Acetalin 2 Opioid Receptor Antagonist 2 Ac RFMWMK NH2 152274 66 3 Acetalin 3 Opioid Receptor Antagonist 3 Ac RFMWMT NH2 152274 67 4