Ac N Me Tyr Val Ala Asp aldehyde pseudo acid 160806 26 8 Ac Leu Val Phe aldehyde 160369 84 6 Adrenomedullin 22 52 human TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY NH2 159899 65 7 Adrenomedullin 1 50 rat YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY NH2 Disulfidebridge 14 19 159964 38 2 Ac Tyr PO3H2 Glu Glu Ile Glu OH 159439 02 8 Antioxidant peptide A PHCKRM 159147 88 3 Ac Nle OH 15891 49 3 Acetyl Leu28·31 Neuropeptide Y 24 36 155709 24 3 Ac Ala Ala Ala Ala OH 15483 58 6 Adrenomedullin 13 52 human SFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY NH2 Disulfidebridge 4 9 154765 05 6 Abz Gln Val Val Ala Gly Ala ethylenediamine Dnp 152390 52 8 Acetalin 3 Opioid Receptor Antagonist 3 Ac RFMWMT NH2 152274 67 4 Ac Asp Arg Gly Asp Ser OH 151997 55 6 Acetalin 2 Opioid Receptor Antagonist 2 Ac RFMWMK NH2 152274 66 3 Acetalin 1 Opioid Receptor Antagonist 1 Ac RFMWMR NH2 152274 65 2 Ac Pen Arg Gly Asp Cys OH 151171 08 3 Ac D Met OH 1509 92 8 Ac Thr Val Ser Phe Asn Phe OH 150626 30 5 Ac Lys Fmoc OH 148101 51 3 Adrenomedullin 1 52 human YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY NH2 Disulfidebridge 16 21 148498 78 6 Asn670 Leu671 Amyloid β A4 Protein Precursor770 667 675 150234 52 9 Ac Met Ala Ser OH 149151 19 9 Ac Leu Val Lys aldehyde 147600 40 6 Ac Gly Lys OMe 14752 92 2 Activated Protein C 390 404 human YGVYTKVSRYLDWIH 146340 20 7 Ac a CGRP 19 37 human 145459 34 3 Ac Cys farnesyl Val Ile Met OH 144608 65 1 Angiotensin I Converting Enzyme ACE Inactivator 144085 32 5 Ac DTrp16 Endothelin 1 16 21 human 143037 33 6 Abz Ala Phe Ala Phe Asp Val Phe 3 nitro Tyr Asp OH 143147 74 4