Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
Galanin Message Associated Peptide GMAP 25 41 amide TIMEFLAFLHLKEAGAL NH2 132567 21 6 Galanin Message Associated Peptide GMAP 16 41 amide LQSEDKAIRTIMEFLAFLHLKEAGAL NH2 129541 35 1 G R G D S P C 126646 79 5 GRADSPK GRADSPK 125455 58 5 Galanin Message Associated Peptide GMAP 44 59 amide LPGLPSAASSEDAGQS NH2 125455 59 6 Galanin 1 16 porcine rat GWTLNSAGYLLGPHAI 125118 77 6 ganirelix 123246 29 7 GLSYM 00505 Boc Ala Ala Pro Ala pNA 121570 42 1 Product Name Boc Ala Ala Pro Ala pNA Molecular Formula C25H36N6O8 CAS No 121570 42 1 Galanin human GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS 119418 04 1 Galanin rat GWTLNSAGYLLGPHAIDNHRSFSDKHGLT NH2 114547 31 8 Gastric Inhibitory Polypeptide 6 30 amide human 1139691 72 7 GRPP human 1132745 52 8 Glucagon Like Peptide 1 7 36 amide human HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR NH2 107444 51 9 Gln11 beta Amyloid 1 40 DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 106686 61 7 Glucagon Like Peptide 1 7 37 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 106612 94 6 Glycogen Synthase 1 8 PLSRTLSVAAKK NH2 PLSRTLSVAAKK 105802 84 4 GTP Binding Protein Fragment Gs alpha Gln22 Amyloid β Protein 1 40 144410 00 4 GnRH Associated Peptide GAP 1 13 human Glycyl L Histidyl L Lysine Gastrin I 1 14 human Glu1 Fibrinopeptide B Glutaral 5 and Deciquam5 Solution Garlicin 25 Guide Wire General Instruments GYNECOLOGY INSTRUMENT SR S 0403 Glycine GETT Certified Quality Mouse MSI U10030 LD Waterproof Medical Touch Scroll Mouse Laser detection GETT Certified Quality Mouse MSI U10050 Waterproof Medical Click Scroll Compact Mouse Laser detection