Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
GRADSPK GRADSPK 125455 58 5 Galanin 1 16 porcine rat GWTLNSAGYLLGPHAI 125118 77 6 ganirelix 123246 29 7 GLSYM 00505 Boc Ala Ala Pro Ala pNA 121570 42 1 Product Name Boc Ala Ala Pro Ala pNA Molecular Formula C25H36N6O8 CAS No 121570 42 1 Galanin human GWTLNSAGYLLGPHAVGNHRSFSDKNGLTS 119418 04 1 Galanin rat GWTLNSAGYLLGPHAIDNHRSFSDKHGLT NH2 114547 31 8 Gastric Inhibitory Polypeptide 6 30 amide human 1139691 72 7 GRPP human 1132745 52 8 Glucagon Like Peptide 1 7 36 amide human HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR NH2 107444 51 9 Gln11 beta Amyloid 1 40 DAEFRHDSGYQVHHQKLVFFAEDVGSNKGAIIGLMVGGVV 106686 61 7 Glucagon Like Peptide 1 7 37 HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG 106612 94 6 Glycogen Synthase 1 8 PLSRTLSVAAKK NH2 PLSRTLSVAAKK 105802 84 4 GTP Binding Protein Fragment Gs alpha GnRH Associated Peptide GAP 1 13 human Glycyl L Histidyl L Lysine Gastrin I 1 14 human Glu1 Fibrinopeptide B Gln22 Amyloid β Protein 1 40 144410 00 4 Glutaral 5 and Deciquam5 Solution Garlicin 25 Guide Wire General Instruments GYNECOLOGY INSTRUMENT SR S 0403 Glycine GETT Certified Quality Mouse MSI U10030 LD Waterproof Medical Touch Scroll Mouse Laser detection GETT Certified Quality Mouse MSI U10030 Waterproof Medical Touch Scroll Mouse Optical detection GETT Certified Quality Mouse MSI U10050 Waterproof Medical Click Scroll Compact Mouse Laser detection GETTCertified Quality Mouse MSI U10010 Waterproof Medical Click Scroll Optical Mouse GETT Certified Quality Mouse MSI G10010 2 4G Wireless Medical Optical Mouse Gluck rib shears