Tris 2 2 bipyridine ruthenium dichloride Tulathromycin CAS 217500 96 4 Training Stairs Testosterone enanthate Testosterone propionate Tadalafil Testosterone undecanoate Testosterone isocaproate Testosterone phenylpropionate Tracheostomy Tube Holder Transducer Holder thepphylline theobromine Tofacitinib Ticagrelor Tribulus Terrestris P E Triptosan Triangular bandage Tofacitinib Citrate Tretinoin Thiocarbazide Thiocarbazide Teriparatide Acetate TRAUMA EVALUATION SET TRAUMA NURSING MANIKIN Three way stopcock Tracheobronchial Tube TENOFOVIR DISOPROXIL FUMARATE Tofacitinib citrate Ticagrelor

Traction device for arthroscopy of shoulder and wrist The Secret of Spine Surgery and Spine Operating Table Table for Gynecological Exam Gyencology Examination Chair from China Tweezer Locking Tweezer Locking Tissue Plier Tissue Plier TBA25FR Fully Auto Clinical Chemistry Analyzer Tatainum Needle Holder titanuim Micro Scissor Titanium Forcep Tissue processor Trocar For Chest Drainage Tube Thermometer Digital Thermomete Rnon Contact Forehead Infrared Thermometer Me IR2000 Three Function Medical bed Electric Hospital Bed Da 3 2 ECOM6 Tyr0 Somatostatin 28 YSANSNPAMAPRERKAGCKNFFWKTFTSC Disulfidebridge 18 29 86649 84 5 Tyr34 pTH 7 34 amide bovine 86292 93 5 Thymopoietin II 32 35 85466 18 8 Thymopoietin II 32 34 85465 82 3 TRH Gly 85344 77 0 Tyr52 Asp76 pTH 52 84 human 84069 01 2 Tyr CRF ovine 83930 34 1 Tyrosine Kinase Peptide 3 RRLIEDAEYAARG RRLIEDAEYAARG 81156 93 6 Trt Thr OH DEA 80514 77 8 Thymosin β4 Acetate 77591 33 4 Thymopoietin II 34 36 75958 14 4 Thymopoietin II 33 36 75957 56 1 T20 Ac YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF NH2 74038 65 6 Tos Gly Pro Lys pNA 73392 19 5 Tuftsin 72103 53 8

Thymopentin 69558 55 0 Tyr4 Bombesin Pyr QRYGNQWAVGHLM NH2 67338 70 9 Triisopropylsilane L 6485 79 6 Tfa Val Tyr Val OH 64577 63 5 Thymic Factor 63958 90 7 Thymosin Alpha 1 62304 98 7 Triethylsilane 617 86 7 Thr6 Bradykinin 6120 63 4 Thr4 Gly7 Oxytocin 60786 59 6 Tyr1 Somatostatin 14 YGCKNFFWKTFTSC Disulfidebridge 3 14 59481 23 1 Tyr Somatostatin 14 58100 03 1 Triptorelin 57773 63 4 Tyr0 C Peptide human 57327 90 9 Thymopoietin I II 29 41 bovine 56795 64 3 Tyr8 Substance P 55614 10 3 TCEP ·HCl 51805 45 9 Tyr D Dab4 Arg5 D Trp8 cyclo Somatostatin 14 4 11 496849 46 8 Thymus and Activation Regulated Chemokine human 439555 96 1 TRH 40216 95 3 TPCK 402 71 1 TACE FRET Substrate I DABCYL Leu Ala Gln Ala Val Arg Ser Ser Ser Arg EDANS 396716 14 6 Thr46 Osteocalcin 45 49 human 352279 02 8 Tyr Big Endothelin 1 fragment 22 38 human 348128 18 7 Thyrotropin Releasing Hormone free acid TRH free acid Pyr HP 34367 54 9 Tyr Bradykinin 33289 76 8 TCTU 330641 16 2 Triphosgene 32315 10 9 Tyr8 Bradykinin 32222 00 7 Tyr0 Prepro Atrial Natriuretic Factor 104 123 human 309245 24 7 Tetrazole 288 94 8

Thymopoietin II 32 36 ethyl ester 283167 49 7 TIP 39 Tuberoinfundibular Neuropeptide SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP 277302 47 3 Tertiapin Q 252198 49 5 Thyrotropin Releasing Hormone TRH Pyr HP NH2 24305 27 9 TLCK 2364 87 6 Thrombin B 147 158 human 207553 42 2 TFLLR NH2 Protease Activated Receptor 1 PAR1 Agonist 197794 83 5 Teduglutide 197922 42 2 Tyr Amyloid P Component 27 38 amide 198268 71 2 Tyr22 a CGRP 22 37 rat 198277 54 2 Tyr9 β MSH porcine Tyr49 β Lipotropin 41 58 porcine 198281 81 1 Tyrosinase 243 251 human 197171 78 1 Trp Asn Arg Gln Leu Tyr Pro Glu Trp Thr Glu Ala Gln Arg Leu Asp 195523 86 5 TNO211 DABCYL γ Abu Pro Gln Gly Leu Glu EDANS Ala Lys NH2 193475 71 7 TAT 47 57 YGRKKRRQRRR 191936 91 1 TRH AMC 190836 86 3 Tyr0 Urocortin rat 187111 93 9 Tyr Lys Gly Cyclo Glu26 Lys29 Pro34 Neuropeptide Y 25 36 185032 24 0 tert Butyldimethylsilyl Chloride 18162 48 6 Tritrpticin 179264 81 4 TOS ARG OME HCL 1784 03 8 Tyr Ser Phe Val His His Gly Phe Phe Asn Phe Arg Val Ser Trp Arg Glu Met Leu Ala 175799 54 9 Tyrosinase 192 200 SEIWRDIDF 170294 35 6 Trp6 LHRH 156126 74 8 TTA 386 152847 08 0 Tyr36 pTH Related Protein 1 36 amide chicken 152617 91 9 Thrombospondin 1 1016 1021 human bovine mouse 149234 06 0 Thrombospondin 1 1016 1023 human bovine mouse 149234 04 8 T22 147658 54 6 Terlipressin 14636 12 5