Tyr Amyloid P Component 27 38 amide 198268 71 2 Tyr22 a CGRP 22 37 rat 198277 54 2 Tyr9 β MSH porcine Tyr49 β Lipotropin 41 58 porcine 198281 81 1 Tyrosinase 243 251 human 197171 78 1 Trp Asn Arg Gln Leu Tyr Pro Glu Trp Thr Glu Ala Gln Arg Leu Asp 195523 86 5 TNO211 DABCYL γ Abu Pro Gln Gly Leu Glu EDANS Ala Lys NH2 193475 71 7 TAT 47 57 YGRKKRRQRRR 191936 91 1 TRH AMC 190836 86 3 Tyr0 Urocortin rat 187111 93 9 Tyr Lys Gly Cyclo Glu26 Lys29 Pro34 Neuropeptide Y 25 36 185032 24 0 tert Butyldimethylsilyl Chloride 18162 48 6 Tritrpticin 179264 81 4 TOS ARG OME HCL 1784 03 8 Tyr Ser Phe Val His His Gly Phe Phe Asn Phe Arg Val Ser Trp Arg Glu Met Leu Ala 175799 54 9 Tyrosinase 192 200 SEIWRDIDF 170294 35 6 Trp6 LHRH 156126 74 8 TTA 386 152847 08 0 Tyr36 pTH Related Protein 1 36 amide chicken 152617 91 9 Thrombospondin 1 1016 1021 human bovine mouse 149234 06 0 Thrombospondin 1 1016 1023 human bovine mouse 149234 04 8 T22 147658 54 6 TIPP 146369 65 5 Terlipressin 14636 12 5 Thrombin Receptor 42 48 Agonist human SFLLRNP 145229 76 1 t BuDSer6 AzaGly10 LH RH 145781 92 6 Tyr6 D Phe7 D His9 Substance P 6 11 145194 26 9 TNF α 31 45 human RRANALLANGVELRD 144796 71 4 TNF α 46 65 human 144796 72 5 Tyr W MIF 1 YPWG NH2 144450 13 5 Thrombospondin Analog 143740 28 7

Thrombin Receptor Agonist amide SFLLR NH2 SFLLR NH2 141923 41 3 Tyr0 C Type Natriuretic Peptide 32 53 human porcine rat 142878 79 3 TRAP 14 amide 141923 36 6 Thrombin Receptor Agonist FLLRN FLLRN 141136 84 7 Thrombin Receptor Activator for Peptide 6 TRAP 6 SFLLRN 141136 83 6 Tyr PDGF A Chain 194 211 137132 69 5 TOTU 136849 72 4 Tyr ACTH 4 10 131374 17 9 Tyr OMe 21 Neuropeptide Y human YPSKPDNPGEDAPAEDMARYY OMe SALRHYINLITRQRY NH2 131256 74 1 Tyr ACTH 4 9 129813 57 6 Trp63 64 C3a 63 77 WWGKKYRASKLGLAR 130154 64 2 Tyr38 Phe42 46 Osteocalcin 38 49 human 129356 77 0 Tos Gly Pro Lys AMC 128202 25 5 TPTU 125700 71 2 TBTU 125700 67 6 TDBTU 125700 69 8 Tyr15 Fibrinopeptide B 125455 56 3 Tyr α CGRP human 124756 98 5 Tyr27 a CGRP 27 37 canine mouse rat 124501 79 7 Tos Gly Pro Arg AMC · HCl 117961 27 0 Tyr0 Atrial Natriuretic Peptide 5 27 Tyr0 Atriopeptin II rat YSSCFGGRIDRIGAQSGLGCNSFR Disulfidebridge 4 20 117856 13 0 T F Q A Y P L R E A 117592 22 0 Tyr0 Neurokinin A YHKTDSFVGLM NH2 116868 93 0 TCEP 115 96 8 Thr Ala Pro Arg Atrial Natriuretic Peptide Urodilatin human TAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY Disulfidebridge 11 27 115966 23 9 Tos Arg OH 1159 15 5 Tyr4 D Phe12 Bombesin Pyr QRYGNQWAVGfLM NH2 108437 89 4 tos gly oh 1080 44 0 TSTU 105832 38 0 TA 0910 taltirelin

Tyr0 Fibrinopeptide A Tyr C Peptide Tyr CRF human rat Tos Gly Pro OH Thioanisole L Tooth Forceps for upper roots Tilmicosin Solution 10 Timicosin Premix 10 Thiamethoxam wp1 10 Toltrazuil oral solution 2 5 Tianeptine sodium salt The device is light laser therapy MILTA F5 A The device is light laser therapyMILTA F5 BIO Tyramine p hydroxy phenyl ethylamine Triazole carboxylate Tyramine hydrochloride Test Lung Tubings Fittings TBP 1002 Constant Flow Pump The CPAP System TONSIL SNARE SR S 0045 Tert Butyl 4R cis 6 formaldehydel 2 2 dimethyl 1 3 dioxane 4 acetate CAS 124752 23 4 Assay 99 Two Function Orthopedics Traction Bed Three Way Stopcock Tourniquet Three function Electric Hospital Bed Three function electric hospital bed Three function manual hospital bed two crank manual medical bed Thyroid Stimulating Hormone Quantitative Detection Kit Chemiluminescent Immunoassay

Total Thyroxine Quantitative Detection Kit Chemiluminescent Immunoassay Total Triiodothyronine Quantitative Detection Kit Chemiluminescent Immunoassay Total Prostate Specific Antigen Quantitative Detection kit Chemiluminescent Immunoassay THERMOFORM Tumor Associated Antigen CA125 Quantitative Detection Kit Chemiluminescent Immunoassay The disposable use prostate infusion tube The silicone catheters Transparent IV Dressing Transparent Wound Dressing Transit Type Electronic Wheelchair USI 111A TABLETS CAPSULES Telmisartan Thiourea T1 type Tourniquet Radial Artery Compression Device tweezers Troemner Telemedicine Bluetooth ambulatory arm blood pressure monitor Two function electric hospital bed Three Function Semi electric hospital bed Three function manual hospital bed for sale Tadalafil Tetracaine Talc trans Cinnamic acid Theophylline Tauroursodeoxycholic Acid Trimetazidine dihydrochloride Thymol Tacrolimus Tesamorelin