Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
Cyclo Gly Arg Gly Asp Ser Pro Ala 128857 77 2 Cys2 Neuropeptide Y 1 4 8 aminooctanoyl D Cys27 Neuropeptide Y 25 32 128806 04 2 Calpain Inhibitor Peptide B27 WT DPMSSTYIEELGKREVTIPPKYRELLA 128578 18 7 C Type Natriuretic Peptide 32 53 human porcine GLSKGCFGLKLDRIGSMSGLGC Disulfidebridge 6 22 127869 51 6 cAMP Dependent Protein Kinase Inhibitor PKI tide IAAGRTGRRQAIHDILVAA 126370 52 3 Cecropin P1 porcine 125667 96 1 CYS BZL 84 CD4 81 92 123380 68 7 Corazonin American Cockroach Periplaneta americana Pyr TFQYSRGWTN NH2 122929 08 2 Calcitonin porcine CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP NH2 Disulfidebridge 1 7 12321 44 7 Cholecystokinin Octapeptide 1 3 desulfated 121880 94 2 Cholecystokinin Octapeptide 1 5 desulfated 121880 96 4 Cetrorelix Acid 120287 85 6 CRF 6 33 human rat 120066 38 8 Calcitonin Gene Related Peptide CGRP 8 37 human VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF NH2 119911 68 1 Calfluxin 118812 41 2 Calmodulin Dependent Protein Kinase II 290 309 LKKFNARRKLKGAILTTMLA 115044 69 4 CGRP chicken 114679 42 4 Calcineurin PP2B Substrate DLDVPIPGRFDRRVSVAAE Non Phosphorylated DLDVPIPGRFDRRVSVAAE 113873 67 9 Cyclohexylacetyl Phe Arg Ser Val Gln NH2 113584 01 3 Calpain Inhibitor II 110115 07 6 Crustacean Cardioactive Peptide CCAP amide 107090 96 0 cyclo Arg Ala Asp d Phe Cys Cys2 Tyr3 Orn5 Pen7 Somatostatin 14 7 14 amide fCYw Orn T Pen T NH2 Disulfidebridge 2 7 Cyclo Gly Phe Calcitonin Gene Related Peptide II human cAMP Dependent Protein Kinase Inhibitor 5 22 amide Wiptide TTYADFIASGRTGRRNAI NH2 Cholecystokinin 10 20 CRF HUMAN RAT Clopidogrel Bisulfate Compressor Nebulizer COMPACT