Cholecystokinin Octapeptide 1 2 desulfated 22840 03 5 Cyclo Pro Thr 227777 31 3 Cys Npys Antennapedia Peptide amide C Npys RQIKIWFQNRRMKWKK NH2 220337 24 6 Caspase 6 Mch2 Substrate 2 fluorogenic Mca VQVDGW K Dnp NH2 219138 06 4 Caspase 8 Substrate 1m fluorogenic Ac IETD AMC 219138 21 3 Caspase 8 Substrate 1f z fluorogenic Z IETD AFC 219138 02 0 Caspase 6 Mch2 Substrate 1m fluorogenic Ac VEID AMC 219137 97 0 Caspase 1 ICE Substrate 2f fluorogenic Ac YVAD AFC 219137 85 6 Cyclo Ser Tyr 21754 31 4 CART 55 102 human VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL Disulfidebridge 74 94 68 86 and88 101 214050 22 3 CART 62 76 rat human 210978 19 1 Caspase 8 Substrate 1f fluorogenic Ac IETD AFC 211990 57 7 Calcitonin human CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP NH2 Disulfidebridge 1 7 21215 62 3 CART 61 102 human rat 209615 75 8 CART 55 102 rat IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL Disulfidebridge 74 94 68 86 and88 101 209615 79 2 Caerulein desulfated 20994 83 6 Caspase 2 ICH 1 Substrate 1f fluorogenic Ac VDVAD AFC 210344 94 8 Caspase 9 Substrate 1f fluorogenic Ac LEHD AFC 210345 03 2 Cyclo Trp Tyr 20829 53 2 Cyclo Trp Trp 20829 55 4 Compstatin 206645 99 0 Caspase 3 Apopain Substrate 1f fluorogenic Ac DEVD AFC 201608 14 2 Cyclo Val Val 19943 16 9 Casein Kinase II Receptor Peptide RREEETEEE 198481 81 1 Cholecystokinin Octapeptide 1 6 desulfated 198483 36 2 Cholecystokinin Flanking Peptide non sulfated SAEEYEYPS 198483 37 3 Cyclolinopeptide B 193139 41 2 Caspase 3 Apopain Substrate 1 chromogenic Ac DEVD pNA 189950 66 1 Caspase 1 Substrate V Fluorogenic Mca YVADAP K Dnp 189696 01 3 Caspase 6 Mch2 Substrate 1 chromogenic Ac VEID pNA 189684 54 6