Cyclo Arg Gly Asp D Phe Val 137813 35 5 Cyclo D Trp D Asp Pro D Val Leu 136553 81 6 Cyclo D Glu Ala D allo Ile Leu D Trp 136553 74 7 Calpain Inhibitor I 13632 32 1 Carassin Carrassius Auratus 133950 47 7 Conantokin G GE Gla Gla LQ Gla NQ Gla LIR Gla KSN NH2 133628 78 1 Chromostatin bovine SDEDSDGDRPQASPGLGPGP 133633 11 1 Calpain Inhibitor IV 133407 82 6 C5a Inhibitory Sequence 133214 60 5 CBZ Osu Z OSu 13139 17 8 C Reactive Protein CRP 201 206 130348 99 1 Cetrorelix Acetate 130143 01 0 Carbomethoxycarbonyl DPro DPhe OBzl 129988 00 7 Carbomethoxycarbonyl Pro Phe OBzl 129987 97 9 Cyclo Gly Arg Gly Asp Ser Pro Ala 128857 77 2 Calcitonin Gene Related Peptide 8 37 rat 129121 73 9 Cys2 Neuropeptide Y 1 4 8 aminooctanoyl D Cys27 Neuropeptide Y 25 32 128806 04 2 Calpain Inhibitor Peptide B27 WT DPMSSTYIEELGKREVTIPPKYRELLA 128578 18 7 C Type Natriuretic Peptide 32 53 human porcine GLSKGCFGLKLDRIGSMSGLGC Disulfidebridge 6 22 127869 51 6 cAMP Dependent Protein Kinase Inhibitor PKI tide IAAGRTGRRQAIHDILVAA 126370 52 3 Cecropin P1 porcine 125667 96 1 CYS BZL 84 CD4 81 92 123380 68 7 Calcitonin porcine CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP NH2 Disulfidebridge 1 7 12321 44 7 Corazonin American Cockroach Periplaneta americana Pyr TFQYSRGWTN NH2 122929 08 2 Cholecystokinin Octapeptide 1 5 desulfated 121880 96 4 Cholecystokinin Octapeptide 1 3 desulfated 121880 94 2 Cetrorelix Acid 120287 85 6 CRF 6 33 human rat 120066 38 8 Calcitonin Gene Related Peptide CGRP 8 37 human VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF NH2 119911 68 1 Calfluxin 118812 41 2

Calmodulin Dependent Protein Kinase II 290 309 LKKFNARRKLKGAILTTMLA 115044 69 4 CGRP chicken 114679 42 4 Calcineurin PP2B Substrate DLDVPIPGRFDRRVSVAAE Non Phosphorylated DLDVPIPGRFDRRVSVAAE 113873 67 9 Cyclohexylacetyl Phe Arg Ser Val Gln NH2 113584 01 3 Calpain Inhibitor II 110115 07 6 Crustacean Cardioactive Peptide CCAP amide 107090 96 0 cyclo Arg Ala Asp d Phe Cys Cys2 Tyr3 Orn5 Pen7 Somatostatin 14 7 14 amide fCYw Orn T Pen T NH2 Disulfidebridge 2 7 Calcitonin Gene Related Peptide II human Cyclo Gly Phe Cholecystokinin 10 20 cAMP Dependent Protein Kinase Inhibitor 5 22 amide Wiptide TTYADFIASGRTGRRNAI NH2 Clopidogrel Bisulfate Compressor Nebulizer COMPACT Compound Fipronil Cranberry extract powder with high quality Cinnamon Bark Extract CT MRI DSA angiographic syringes Closantel Sodium 98 Cypermethrin 10 EC Cyromazine premix 1 Cyromazine 98 Nuoyingjing Cromazine 2 SG Cefminox Sodium Cefminox Sodium Cefminox Sodium cefotaxime sodium ceftazidime pentahydrate Coulometric Karl Fischer Reagents  CPAP System

Celecoxib CAS 169590 42 5 Colin Cleanroom Series Cleanzone 5000 Series C Peptide Quantitative Detection Kit Chemiluminescent Immunoassay Carbohydrate Antigen CA19 9 Quantitative Detection Kit Chemiluminescent Immunoassay Carcinoembryonic Antigen Quantitative Detection Kit Chemiluminescent Immunoassay condom catheter chiller Case Former Case Sealing System CLEANTYPE KSI U10080 Silicon Trackpad keyboard with number pad and touch pad Added CLEANTYPE BRAND CLEANTYPE WAVE COMPACT KSI B10030 New facelifted washable Bluetooth Mini Keyboard with magnet CLEANTYPE KSI U10080 Silicon Trackpad keyboard with number pad and touch pad CLEANTYPE medical KSI U10050 Washable silicon backlight keyboard with number pad EN certified CLEANTYPE magnetic KSI U10020 Washable silicon backlight keyboard with number pad and magnet CLEANTYPE WAVE CLASSIC KPL B10010 Dual Bluetooth USB washable Stand alone keyboard Without protective cover CLEANTYPE WAVE CLASSIC KSI B10020 Dual Bluetooth USB washable keyboard with protective cover CLEANTYPE EASY BASIC KPL U10060 Washable office keyboard with Cleanmode CleanDesk KL22217 Washable Office Keyboard Cleankeys CK4 KR23211 Wired Glass keyboard with number pad and touch pad Cleankeys CK3 15 KR21205 wireless Glass keyboard Conservative Dentistry Crash Cart COLLAPSIBLE SIDE RAILINGS COLLAPSIBLE BEDSIDE RAILINGS centrifuge tube Canthaxanthin Centrifuge children dental instrument

Cefminox sodium Cefmetazole sodium Cefmenoxime Hydrochloride Cefmenoxime hemihydrochloride Cefdinir Cefcapen pivoxile Cefazedone acid Cefatrizine propylene glycol Cefaclor Cefotaxime acid Cefoperazone acid sod Cefotaxime sodium Cefotiam dihydrochloride Cefpiramide acid sodium Cefoxitin sodium Ceftizoxime acid sodium Ceftezole adid sod Cefteram acid Cefroxadine trihydrate Cefpodoxime Proxetil Cervical Biopsy Forcep Cefuroxime acid sod axetile Cleanroom system wall panels Cyanamide Checkvalve Coat Type Apron Coated Fabrics for Healthcare China made beauty equipment for body moulding Civilion Face Shield custom oem 21g syringe needle