C5a Inhibitory Sequence 133214 60 5 CBZ Osu Z OSu 13139 17 8 C Reactive Protein CRP 201 206 130348 99 1 Cetrorelix Acetate 130143 01 0 Carbomethoxycarbonyl DPro DPhe OBzl 129988 00 7 Carbomethoxycarbonyl Pro Phe OBzl 129987 97 9 Cys2 Neuropeptide Y 1 4 8 aminooctanoyl D Cys27 Neuropeptide Y 25 32 128806 04 2 Cyclo Gly Arg Gly Asp Ser Pro Ala 128857 77 2 Calcitonin Gene Related Peptide 8 37 rat 129121 73 9 Calpain Inhibitor Peptide B27 WT DPMSSTYIEELGKREVTIPPKYRELLA 128578 18 7 C Type Natriuretic Peptide 32 53 human porcine GLSKGCFGLKLDRIGSMSGLGC Disulfidebridge 6 22 127869 51 6 cAMP Dependent Protein Kinase Inhibitor PKI tide IAAGRTGRRQAIHDILVAA 126370 52 3 Cecropin P1 porcine 125667 96 1 CYS BZL 84 CD4 81 92 123380 68 7 Corazonin American Cockroach Periplaneta americana Pyr TFQYSRGWTN NH2 122929 08 2 Calcitonin porcine CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP NH2 Disulfidebridge 1 7 12321 44 7 Cholecystokinin Octapeptide 1 5 desulfated 121880 96 4 Cholecystokinin Octapeptide 1 3 desulfated 121880 94 2 Cetrorelix Acid 120287 85 6 CRF 6 33 human rat 120066 38 8 Calcitonin Gene Related Peptide CGRP 8 37 human VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF NH2 119911 68 1 Calfluxin 118812 41 2 Calmodulin Dependent Protein Kinase II 290 309 LKKFNARRKLKGAILTTMLA 115044 69 4 CGRP chicken 114679 42 4 Calcineurin PP2B Substrate DLDVPIPGRFDRRVSVAAE Non Phosphorylated DLDVPIPGRFDRRVSVAAE 113873 67 9 Cyclohexylacetyl Phe Arg Ser Val Gln NH2 113584 01 3 Calpain Inhibitor II 110115 07 6 Crustacean Cardioactive Peptide CCAP amide 107090 96 0 cyclo Arg Ala Asp d Phe Cys Cys2 Tyr3 Orn5 Pen7 Somatostatin 14 7 14 amide fCYw Orn T Pen T NH2 Disulfidebridge 2 7

Cyclo Gly Phe Calcitonin Gene Related Peptide II human cAMP Dependent Protein Kinase Inhibitor 5 22 amide Wiptide TTYADFIASGRTGRRNAI NH2 Cholecystokinin 10 20 Clopidogrel Bisulfate Compressor Nebulizer COMPACT CT MRI DSA angiographic syringes Cranberry extract powder with high quality Cinnamon Bark Extract Compound Fipronil Closantel Sodium 98 Cypermethrin 10 EC Cyromazine premix 1 Cyromazine 98 Nuoyingjing Cromazine 2 SG ceftazidime pentahydrate Cefminox Sodium cefotaxime sodium Cefminox Sodium Cefminox Sodium Coulometric Karl Fischer Reagents  CPAP System Celecoxib CAS 169590 42 5 Colin Cleanroom Series Cleanzone 5000 Series C Peptide Quantitative Detection Kit Chemiluminescent Immunoassay Carbohydrate Antigen CA19 9 Quantitative Detection Kit Chemiluminescent Immunoassay Carcinoembryonic Antigen Quantitative Detection Kit Chemiluminescent Immunoassay condom catheter

Case Sealing System chiller Case Former CLEANTYPE KSI U10080 Silicon Trackpad keyboard with number pad and touch pad Added CLEANTYPE BRAND CLEANTYPE KSI U10080 Silicon Trackpad keyboard with number pad and touch pad CLEANTYPE medical KSI U10050 Washable silicon backlight keyboard with number pad EN certified CLEANTYPE magnetic KSI U10020 Washable silicon backlight keyboard with number pad and magnet CLEANTYPE WAVE COMPACT KSI B10030 New facelifted washable Bluetooth Mini Keyboard with magnet CLEANTYPE WAVE CLASSIC KSI B10020 Dual Bluetooth USB washable keyboard with protective cover CLEANTYPE EASY BASIC KPL U10060 Washable office keyboard with Cleanmode CLEANTYPE WAVE CLASSIC KPL B10010 Dual Bluetooth USB washable Stand alone keyboard Without protective cover Cleankeys CK4 KR23211 Wired Glass keyboard with number pad and touch pad CleanDesk KL22217 Washable Office Keyboard Cleankeys CK3 15 KR21205 wireless Glass keyboard Conservative Dentistry Crash Cart COLLAPSIBLE SIDE RAILINGS COLLAPSIBLE BEDSIDE RAILINGS centrifuge tube Canthaxanthin Centrifuge children dental instrument Cefaclor Cefotaxime acid Cefoperazone acid sod Cefminox sodium Cefmetazole sodium Cefmenoxime Hydrochloride Cefmenoxime hemihydrochloride Cefdinir

Cefcapen pivoxile Cefazedone acid Cefatrizine propylene glycol Cefteram acid Cefroxadine trihydrate Cefpodoxime Proxetil Cefpiramide acid sodium Cefoxitin sodium Cefotiam dihydrochloride Cefotaxime sodium Ceftezole adid sod Ceftizoxime acid sodium Cefuroxime acid sod axetile Cervical Biopsy Forcep Cleanroom system wall panels Cyanamide Coat Type Apron Checkvalve Coated Fabrics for Healthcare China made beauty equipment for body moulding Civilion Face Shield custom oem 21g syringe needle custom oem 18g 20g 21g 27g 29g 30gsyringe needle Colorful nitrile heavy duty gloves cheap price medical Syringe disposable with needle without needle Luer lock or Luer slip Crown Removers Crown Removers Ceiling mounted double dome led operating light Coverall Calcium plus Vitamin D Soft Capsule