Cyclo D Tyr Arg Gly Asp Cys carboxymethyl OH sulfoxide 143120 27 8 Caspase 1 Inhibitor I 143313 51 3 Cyclo D Phe His Trp Ala Val Gly His Leu Leu 143578 65 8 CKS 17 7 12 141975 99 7 CEF1 Influenza Matrix Protein M1 58 66 GILGFVFTL 141368 69 6 Cys3 6 Tyr8 Pro9 Substance P RPCPQCFYPLM NH2 Disulfidebridge 3 6 141459 28 1 C Type Natriuretic Peptide 1 53 human 141294 77 1 Calcium Calmodulin Dependent Protein Kinase II g 345 358 KSDGGVKKRKSSSS 139143 29 6 Cyclo Arg Ala Asp D Phe Val 137813 36 6 Cyclo Arg Gly Asp D Phe Val 137813 35 5 Cyclo D Glu Ala D allo Ile Leu D Trp 136553 74 7 Cyclo D Trp D Asp Pro D Val Leu 136553 81 6 Calpain Inhibitor I 13632 32 1 Carassin Carrassius Auratus 133950 47 7 Conantokin G GE Gla Gla LQ Gla NQ Gla LIR Gla KSN NH2 133628 78 1 Chromostatin bovine SDEDSDGDRPQASPGLGPGP 133633 11 1 Calpain Inhibitor IV 133407 82 6 C5a Inhibitory Sequence 133214 60 5 CBZ Osu Z OSu 13139 17 8 Carbomethoxycarbonyl DPro DPhe OBzl 129988 00 7 Cetrorelix Acetate 130143 01 0 C Reactive Protein CRP 201 206 130348 99 1 Carbomethoxycarbonyl Pro Phe OBzl 129987 97 9 Calcitonin Gene Related Peptide 8 37 rat 129121 73 9 Cyclo Gly Arg Gly Asp Ser Pro Ala 128857 77 2 Cys2 Neuropeptide Y 1 4 8 aminooctanoyl D Cys27 Neuropeptide Y 25 32 128806 04 2 Calpain Inhibitor Peptide B27 WT DPMSSTYIEELGKREVTIPPKYRELLA 128578 18 7 C Type Natriuretic Peptide 32 53 human porcine GLSKGCFGLKLDRIGSMSGLGC Disulfidebridge 6 22 127869 51 6 cAMP Dependent Protein Kinase Inhibitor PKI tide IAAGRTGRRQAIHDILVAA 126370 52 3 Cecropin P1 porcine 125667 96 1

CYS BZL 84 CD4 81 92 123380 68 7 Calcitonin porcine CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP NH2 Disulfidebridge 1 7 12321 44 7 Corazonin American Cockroach Periplaneta americana Pyr TFQYSRGWTN NH2 122929 08 2 Cholecystokinin Octapeptide 1 3 desulfated 121880 94 2 Cholecystokinin Octapeptide 1 5 desulfated 121880 96 4 Cetrorelix Acid 120287 85 6 CRF 6 33 human rat 120066 38 8 Calcitonin Gene Related Peptide CGRP 8 37 human VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF NH2 119911 68 1 Calfluxin 118812 41 2 Calmodulin Dependent Protein Kinase II 290 309 LKKFNARRKLKGAILTTMLA 115044 69 4 CGRP chicken 114679 42 4 Calcineurin PP2B Substrate DLDVPIPGRFDRRVSVAAE Non Phosphorylated DLDVPIPGRFDRRVSVAAE 113873 67 9 Cyclohexylacetyl Phe Arg Ser Val Gln NH2 113584 01 3 Calpain Inhibitor II 110115 07 6 Crustacean Cardioactive Peptide CCAP amide 107090 96 0 cyclo Arg Ala Asp d Phe Cys Cys2 Tyr3 Orn5 Pen7 Somatostatin 14 7 14 amide fCYw Orn T Pen T NH2 Disulfidebridge 2 7 Cyclo Gly Phe Calcitonin Gene Related Peptide II human Cholecystokinin 10 20 cAMP Dependent Protein Kinase Inhibitor 5 22 amide Wiptide TTYADFIASGRTGRRNAI NH2 CRF HUMAN RAT Clopidogrel Bisulfate Compressor Nebulizer COMPACT CT MRI DSA angiographic syringes Cinnamon Bark Extract Cranberry extract powder with high quality Compound Fipronil Closantel Sodium 98 Cypermethrin 10 EC

Cyromazine premix 1 Cromazine 2 SG Cyromazine 98 Nuoyingjing Cefminox Sodium Cefminox Sodium Cefminox Sodium cefotaxime sodium ceftazidime pentahydrate CPAP System Celecoxib CAS 169590 42 5 Colin Cleanzone 5000 Series Cleanroom Series C Peptide Quantitative Detection Kit Chemiluminescent Immunoassay Carbohydrate Antigen CA19 9 Quantitative Detection Kit Chemiluminescent Immunoassay Carcinoembryonic Antigen Quantitative Detection Kit Chemiluminescent Immunoassay condom catheter Case Former Case Sealing System chiller CLEANTYPE KSI U10080 Silicon Trackpad keyboard with number pad and touch pad Added CLEANTYPE BRAND CLEANTYPE KSI U10080 Silicon Trackpad keyboard with number pad and touch pad CLEANTYPE medical KSI U10050 Washable silicon backlight keyboard with number pad EN certified CLEANTYPE magnetic KSI U10020 Washable silicon backlight keyboard with number pad and magnet CLEANTYPE WAVE COMPACT KSI B10030 New facelifted washable Bluetooth Mini Keyboard with magnet CLEANTYPE WAVE CLASSIC KSI B10020 Dual Bluetooth USB washable keyboard with protective cover CLEANTYPE EASY BASIC KPL U10060 Washable office keyboard with Cleanmode CLEANTYPE WAVE CLASSIC KPL B10010 Dual Bluetooth USB washable Stand alone keyboard Without protective cover Cleankeys CK4 KR23211 Wired Glass keyboard with number pad and touch pad CleanDesk KL22217 Washable Office Keyboard

Cleankeys CK3 15 KR21205 wireless Glass keyboard Conservative Dentistry Crash Cart COLLAPSIBLE SIDE RAILINGS COLLAPSIBLE BEDSIDE RAILINGS centrifuge tube Canthaxanthin Clobazam Centrifuge children dental instrument Cefatrizine propylene glycol Cefaclor Cefazedone acid Cefdinir Cefcapen pivoxile Cefmetazole sodium Cefmenoxime Hydrochloride Cefmenoxime hemihydrochloride Cefotaxime acid Cefoperazone acid sod Cefminox sodium Cefpiramide acid sodium Cefotaxime sodium Cefotiam dihydrochloride Cefoxitin sodium Cefteram acid Cefroxadine trihydrate Cefpodoxime Proxetil Ceftezole adid sod Cefuroxime acid sod axetile