Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
Cyclo Pro Val 2854 40 2 Cyclo D Leu D Pro 274680 11 4 Cyclo Ala Gln 268221 76 7 Cl HOBt 26198 19 6 Cholecystokinin 26 33 CCK8 DYMGWMDF NH2 25679 24 7 CRAMP 18 mouse 256639 17 5 Cholecystokinin Octapeptide 1 4 sulfated 25679 23 6 Cholecystokinin 26 33 CCK Octapeptide sulfated D Y SO3H MGWMDF NH2 25126 32 3 Cyclo D Ala D Ala 23927 13 1 Cholecystokinin Octapeptide 1 2 desulfated 22840 03 5 Cyclo Ser Ser 23409 30 5 Cyclo Pro Thr 227777 31 3 Cys Npys Antennapedia Peptide amide C Npys RQIKIWFQNRRMKWKK NH2 220337 24 6 Caspase 8 Substrate 1m fluorogenic Ac IETD AMC 219138 21 3 Caspase 6 Mch2 Substrate 1m fluorogenic Ac VEID AMC 219137 97 0 Caspase 8 Substrate 1f z fluorogenic Z IETD AFC 219138 02 0 Caspase 6 Mch2 Substrate 2 fluorogenic Mca VQVDGW K Dnp NH2 219138 06 4 Caspase 1 ICE Substrate 2f fluorogenic Ac YVAD AFC 219137 85 6 Cyclo Ser Tyr 21754 31 4 CART 55 102 human VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL Disulfidebridge 74 94 68 86 and88 101 214050 22 3 Calcitonin human CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP NH2 Disulfidebridge 1 7 21215 62 3 Caspase 8 Substrate 1f fluorogenic Ac IETD AFC 211990 57 7 CART 62 76 rat human 210978 19 1 Caspase 9 Substrate 1f fluorogenic Ac LEHD AFC 210345 03 2 Caspase 2 ICH 1 Substrate 1f fluorogenic Ac VDVAD AFC 210344 94 8 CART 61 102 human rat 209615 75 8 CART 55 102 rat IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL Disulfidebridge 74 94 68 86 and88 101 209615 79 2 Caerulein desulfated 20994 83 6 Cyclo Trp Trp 20829 55 4 Cyclo Trp Tyr 20829 53 2
Cecropin A melittin hybrid peptide CA 1 7 M 2 9 NH2 157606 25 2 Cyclo Ala Ser 155225 26 6 Calcitonin 8 32 salmon 155069 90 2 Caspase 1 Inhibitor IV Boc D CMK Boc D OBzl CMK 154674 81 4 Cyclo D Ser Pro D Val Leu D Trp 153982 38 8 Casein Kinase I Substrate RRKDLHDDEEDEAMSITA RRKDLHDDEEDEAMSITA 154444 97 0 Cyclo Ala Arg Gly Asp 3 aminomethylbenzoyl 153381 95 4 Cyclo Gly His 15266 88 3 CEF20 Cytomegalovirus CMV pp65 495 503 NLVPMVATV 153045 21 7 Cyclo D Ala Val 15136 27 3 Cyclo Gly Asn Trp His Gly Thr Ala Pro Asp Trp Val Tyr Phe Ala His Leu Asp Ile Ile Trp OH 151308 48 4 Ceratotoxin A 150671 04 8 Carbohydrate Structure Mimicking Peptide 149635 71 2 Caspase 1 ICE Substrate 2m fluorogenic Ac YVAD AMC 149231 65 2 Caspase 1 ICE Substrate 2 chromogenic Ac YVAD pNA 149231 66 3 Calcineurin Autoinhibitory Fragment ITSFEEAKGLDRINERMPPRRDAMP 148067 21 4 Collagen Type II Fragment 144703 90 2 Cyclo D Phe His Trp Ala Val Gly His Leu Leu 143578 65 8 Cyclo D Tyr Arg Gly Asp Cys carboxymethyl OH sulfoxide 143120 27 8 Caspase 1 Inhibitor I 143313 51 3 CKS 17 7 12 141975 99 7 C Type Natriuretic Peptide 1 53 human 141294 77 1 CEF1 Influenza Matrix Protein M1 58 66 GILGFVFTL 141368 69 6 Cys3 6 Tyr8 Pro9 Substance P RPCPQCFYPLM NH2 Disulfidebridge 3 6 141459 28 1 Calcium Calmodulin Dependent Protein Kinase II g 345 358 KSDGGVKKRKSSSS 139143 29 6 Cyclo Arg Gly Asp D Phe Val 137813 35 5 Cyclo Arg Ala Asp D Phe Val 137813 36 6 Cyclo D Trp D Asp Pro D Val Leu 136553 81 6 Cyclo D Glu Ala D allo Ile Leu D Trp 136553 74 7 Calpain Inhibitor I 13632 32 1