China medical Equipment manufacturter back plate module for Shoulder surgery beach chair positioner shoulder surgery China medical Equipment manufacturter back plate module for Shoulder surgery beach chair positioner shoulder surgery Cordyceps extract Curing Light Without Test Function Classical Silicon Wheel C Arm Image Intensifier College Cork Screw Tip Cork Screw Tip Cork Screw Tip Cork Screw Tip Cork Screw Tip Cryer Elevator 25 Compressor Nebulizer Chymotrypsin Cartridge Based Specific Protein Analyzer Chest and intraperitoneal drainage catheter with Seldinger Technology Connecting pipe Chest and intraperitoneal drainage catheter with Seldinger Technology Compressor NebulizerCN 01WA Compressor NebulizerCN 01MI Compressor NebulizerCN 01W Cordyceps Mushroom CELLUX for hair removal color spot skin care telangiectasis Cyclopropyl bromide CE Marked Hemodialysis Kidney Dialysis Center Patient Therapy Medical Equipment 6008 Compact Medeco Oxygen Concentrator With 14 5Kg Weight And 5 C 40 C Operating Temperature Range Clinic Thearpy Operation table Medical Table Hospital Equipment China 12 32cm Working Distance Operating Light Surgical Lamp700 500 Illumination Depth factory 12 32cm Working Distance Operating Light Surgical Lamp700 500 Coronavirus Ventilator Monitors Medical Respiration

Camera System Microscope Pet Diagnostic Machine Me 6800p Veterinary Portable Ultrasound Scanner ce multi purpose hospital single arm surgical pendant mep sd Ceiling Mounted LED Surgical Shadowless Operation Light 160000 Lux Crais Crais U Corticotropin Releasing Factor CRF human rat SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII NH2 86784 80 7 Colivelin 867021 83 8 Copeptin rat 86280 64 0 cyclo Arg Gly Asp d Phe Cys 862772 11 0 Cyclo D Trp Tyr 852955 00 1 Cys8 pTH 1 8 human 844499 32 7 Calcitonin Gene Related Peptide rat 83651 90 5 CBZ S Phenyl L Cysteine 82611 65 2 Cyclo Phe Trp 82597 82 8 Carboxymethyl Phe Leu OH 81109 85 5 Cholecystokinin Octapeptide 1 4 desulfated 80790 40 5 Cecropin A KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK NH2 80451 04 3 Cecropin B KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL NH2 80451 05 4 Copeptin human 78362 34 2 cyclo Arg Ala Asp d Phe Lys 756500 23 9 Cyclo Gly Trp 7451 73 2 Cyclo Met Met 73037 51 1 C5a Anaphylatoxin 37 53 human 706808 05 1 Cholecystokinin 33 porcine 67256 27 3 cAMP Dependent Protein Kinase Substrate RRKASGP 65189 70 0 C3a 70 77 ASHLGLAR 63555 63 5 Cyclo Ala Ala 5845 61 4 Calcitonin eel CSNLSTCVLGKLSQELHKLQTYPRTDVGAGTP NH2 Disulfidebridge 1 7 57014 02 5 Cyclo His Phe 56586 95 9 Cyclo Ala His 54300 25 3

Cyclo His Pro 53109 32 3 CDI 530 62 1 Cyclo Gly Ser 52661 98 0 Cyclo Asp Gly 52661 97 9 CBZ Cl Z Cl 501 53 1 Copper Peptide 49557 75 7 Calcitonin salmon CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP NH2 Disulfidebridge 1 7 47931 85 1 Cholecystokinin CCK 27 33 CCK7 YMGWMDF NH2 47910 79 2 Cyclo Ala Gly 4526 77 6 Cyclo Gly Gly 4202 74 8 C Peptide 2 rat 41594 08 5 C Peptide 1 rat 41475 27 8 C peptide dog EVEDLQVRDVELAGAPGEGGLQPLALEGALQ 39016 05 2 Cyclo Pro Gly 3 37783 51 0 CRAMP mouse 376364 36 2 Carbetocin 37025 55 1 Cyclo Phe Pro 3705 26 8 Cyclo Gly Pro 3705 27 9 Cyclo Phe Ser 35591 00 5 Cyclo Asp Asp 35309 53 6 Cys39 Tissue Factor 33 53 313642 01 2 Caspase 9 Substrate 2m fluorogenic Ac LEHD AMC 292633 16 0 Cbz D Leu OH 28862 79 5 Cyclo Leu Pro 2873 36 1 Cit5 TRAP 5 287184 84 3 Cyclo Phe Phe 2862 51 3 Cyclo Pro Val 2854 40 2 Cyclo D Leu D Pro 274680 11 4 Cyclo Ala Gln 268221 76 7 Cl HOBt 26198 19 6

Cholecystokinin Octapeptide 1 4 sulfated 25679 23 6 Cholecystokinin 26 33 CCK8 DYMGWMDF NH2 25679 24 7 CRAMP 18 mouse 256639 17 5 Cholecystokinin 26 33 CCK Octapeptide sulfated D Y SO3H MGWMDF NH2 25126 32 3 Cyclo D Ala D Ala 23927 13 1 Cyclo Ser Ser 23409 30 5 Cholecystokinin Octapeptide 1 2 desulfated 22840 03 5 Cyclo Pro Thr 227777 31 3 Cys Npys Antennapedia Peptide amide C Npys RQIKIWFQNRRMKWKK NH2 220337 24 6 Caspase 8 Substrate 1m fluorogenic Ac IETD AMC 219138 21 3 Caspase 6 Mch2 Substrate 2 fluorogenic Mca VQVDGW K Dnp NH2 219138 06 4 Caspase 8 Substrate 1f z fluorogenic Z IETD AFC 219138 02 0 Caspase 6 Mch2 Substrate 1m fluorogenic Ac VEID AMC 219137 97 0 Caspase 1 ICE Substrate 2f fluorogenic Ac YVAD AFC 219137 85 6 Cyclo Ser Tyr 21754 31 4 CART 55 102 human VPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL Disulfidebridge 74 94 68 86 and88 101 214050 22 3 Calcitonin human CGNLSTCMLGTYTQDFNKFHTFPQTAIGVGAP NH2 Disulfidebridge 1 7 21215 62 3 Caspase 8 Substrate 1f fluorogenic Ac IETD AFC 211990 57 7 CART 62 76 rat human 210978 19 1 Caspase 9 Substrate 1f fluorogenic Ac LEHD AFC 210345 03 2 Caspase 2 ICH 1 Substrate 1f fluorogenic Ac VDVAD AFC 210344 94 8 Caerulein desulfated 20994 83 6 CART 55 102 rat IPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL Disulfidebridge 74 94 68 86 and88 101 209615 79 2 CART 61 102 human rat 209615 75 8 Cyclo Trp Trp 20829 55 4 Cyclo Trp Tyr 20829 53 2 Compstatin 206645 99 0 Caspase 3 Apopain Substrate 1f fluorogenic Ac DEVD AFC 201608 14 2 Cyclo Val Val 19943 16 9 Cholecystokinin Flanking Peptide non sulfated SAEEYEYPS 198483 37 3