Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
Cortistatin 17 human 189450 19 9 Caspase 2 Substrate chromogenic Ac VDQQD pNA 189684 53 5 Caspase 1 ICE Substrate 3m fluorogenic Ac WEHD AMC 189275 74 9 Cyclo Glu22 Lys26 Leu27 pTH 1 31 amide human 188899 65 2 Cortistatin 14 mouse rat 186901 48 4 Contryphan 183428 21 9 Cys Gly Lys Arg Amyloid β Protein 1 42 1802086 21 0 Caspase 1 Inhibitor II Ac YVAD CMK 178603 78 6 Caerulein Pyr QD Y SO3H TGWMDF NH2 17650 98 5 Cys31 Nva34 Neuropeptide Y 27 36 2 172997 92 1 Caspase 3 Substrate 1m fluorogenic Ac DMQD AMC 169332 61 0 Cyclo Glu Glu 16691 00 2 CDK5 Substrate PKTPKKAKKL PKTPKKAKKL 164669 07 2 Cyclo Ala Glu 16364 36 6 CMV Protease FRET Substrate I DABCYL Arg Gly Val Val Asn Ala Ser Ser Arg Leu Ala EDANS 163265 38 1 Caspase 1 ICE substrate for FRET assays DABCYL YVADAPV EDANS 161877 70 9 C Reactive Protein CRP 174 185 160369 86 8 Cyclo Gly Tyr PO3H2 Val Pro Met Leu 158778 21 3 Coagulation Factor XIIIa 190 230 158455 48 2 Cecropin A melittin hybrid peptide CA 1 7 M 2 9 NH2 157606 25 2 Culekinin Depolarizing Peptide 157536 08 8 Calcitonin 8 32 salmon 155069 90 2 Cyclo Ala Ser 155225 26 6 Caspase 1 Inhibitor IV Boc D CMK Boc D OBzl CMK 154674 81 4 Casein Kinase I Substrate RRKDLHDDEEDEAMSITA RRKDLHDDEEDEAMSITA 154444 97 0 Cyclo D Ser Pro D Val Leu D Trp 153982 38 8 Cyclo Gly His 15266 88 3 CEF20 Cytomegalovirus CMV pp65 495 503 NLVPMVATV 153045 21 7 Cyclo Ala Arg Gly Asp 3 aminomethylbenzoyl 153381 95 4 Cyclo Gly Asn Trp His Gly Thr Ala Pro Asp Trp Val Tyr Phe Ala His Leu Asp Ile Ile Trp OH 151308 48 4
Calcitonin Gene Related Peptide 8 37 rat 129121 73 9 Cyclo Gly Arg Gly Asp Ser Pro Ala 128857 77 2 Cys2 Neuropeptide Y 1 4 8 aminooctanoyl D Cys27 Neuropeptide Y 25 32 128806 04 2 Calpain Inhibitor Peptide B27 WT DPMSSTYIEELGKREVTIPPKYRELLA 128578 18 7 C Type Natriuretic Peptide 32 53 human porcine GLSKGCFGLKLDRIGSMSGLGC Disulfidebridge 6 22 127869 51 6 cAMP Dependent Protein Kinase Inhibitor PKI tide IAAGRTGRRQAIHDILVAA 126370 52 3 Cecropin P1 porcine 125667 96 1 CYS BZL 84 CD4 81 92 123380 68 7 Calcitonin porcine CSNLSTCVLSAYWRNLNNFHRFSGMGFGPETP NH2 Disulfidebridge 1 7 12321 44 7 Corazonin American Cockroach Periplaneta americana Pyr TFQYSRGWTN NH2 122929 08 2 Cholecystokinin Octapeptide 1 3 desulfated 121880 94 2 Cholecystokinin Octapeptide 1 5 desulfated 121880 96 4 Cetrorelix Acid 120287 85 6 CRF 6 33 human rat 120066 38 8 Calcitonin Gene Related Peptide CGRP 8 37 human VTHRLAGLLSRSGGVVKNNFVPTNVGSKAF NH2 119911 68 1 Calfluxin 118812 41 2 Calmodulin Dependent Protein Kinase II 290 309 LKKFNARRKLKGAILTTMLA 115044 69 4 CGRP chicken 114679 42 4 Calcineurin PP2B Substrate DLDVPIPGRFDRRVSVAAE Non Phosphorylated DLDVPIPGRFDRRVSVAAE 113873 67 9 Cyclohexylacetyl Phe Arg Ser Val Gln NH2 113584 01 3 Calpain Inhibitor II 110115 07 6 Crustacean Cardioactive Peptide CCAP amide 107090 96 0 cyclo Arg Ala Asp d Phe Cys Cys2 Tyr3 Orn5 Pen7 Somatostatin 14 7 14 amide fCYw Orn T Pen T NH2 Disulfidebridge 2 7 Calcitonin Gene Related Peptide II human Cyclo Gly Phe Cholecystokinin 10 20 cAMP Dependent Protein Kinase Inhibitor 5 22 amide Wiptide TTYADFIASGRTGRRNAI NH2 CRF HUMAN RAT Clopidogrel Bisulfate