Promotion Good Quality Chinese Famous complete Dental Chair Unit MKT 280 Profession 6 Power Drill Pidotimod 121808 62 6 Proximal Radius Titanium Locking Plate Surgical Orthopedic Implant Proximal Ulnar Titanium Locking Plate Surgical Orthopedic Implant Proximal Clavicle Titanium Locking Plate Surgical Orthopedic Implant Powered Hystera cutter Piroxicam beta cyclodextrin complex plasma sterilizer Portable health integrated machine Proximal Humeral Locking Plate Proximal Lateral Tibia Locking Plate Proximal Femoral Nail Anti rotation PFNA Promethazine hydrochloride 58 33 3 Pregabalin 148553 50 8 probiotics powder PHENYL 4 4 4 HYDROXYPHENYL PIPERAZIN 1 YL PHENYL CARBAMATE Posaconazole Intermediates2 Posaconazole PFM 0146 PFM 0135 Portable dental unit Portable dental units PFNA Magnetic and SONAR Intramedullary nail pulse oximetry Bluetooth version pulse oximetry pulse oximetry Pressure Wrap Parallel Bars with Accessories Physiotherapy Devices NMES Polymer Splint

Polymer Cast Patient trolley Paclitaxel for Injection Albumin bound Percussion Hammers Probes Probes Probes Potassium Chloride Pineneedle Extract Pomegranate P E Polygonum multiflorum Thunb P E Podophyllum Resin CAS 9000 55 9 Pueraria P E Paeoniflorin P E Podophyllotoxin CAS 4354 76 1 Palmatine Portable Type Pressure Steam Sterilizer Protective dress KX 6 PM 900 Patient Monitor Protector Sponges for Endoscope Panax notoginseng saponins polypropylcne mesh network plug poly 1 2 dihydro 2 2 4 trimethyl quinoline Phosphonic dichloride P P methylenebis Pyridinium 1 dodecyl chloride 1 1 Pexiganan Acetate PT141 Acetate Pexiganan Acetate PVC Resuscitator PERCUSSION HAMMERS AND AESTHESIOMETERS 01 105

Pregabalin Pitavastatin clacium PVP One time use of biopsy needle Pulsating Vacuum Autoclave Hospital Pulsating Vacuum Sterilizer Vertical Pressure Steam Sterilizer Precision filter Particulate Respirator Prone Headrest Gel Pad from China Perry Paracetamol Acetaminophen powder DC90 tablet PTCD Catheter With Pigtail PTCD Catheter With Pigtail Papain phytin Plastic apron PLY MASK TIE TYPE LOOP TYPE WHITE BLUE GREEN Portable Color Ultrasound Scanner L50 Pet Hospital Stainless Steel Veterinary Surgical Operation Table Me 5 Portable Digital black ultrasound Scanner ME360 Portable Color Ultrasound Scanner P 50 Pet Clinic Me 4018V Waterproof Veterinary Ultrasound Scanner Machine PCC 88 104 KAERADLIAYLKQATAK 86579 06 8 Pyr Phe Leu pNA 85901 57 1 pTH 1 44 human 85568 24 7 pTH 28 48 human 83286 22 0 Pyr Pro Val pNA 83329 36 6 pp60 v SRC Autophosphorylation Site RRLIEDNEYTARG 81493 98 3 pTH 13 34 human 81306 64 1 PKG Substate RKRSRAE RKRSRAE 81187 14 6 Pyr6 Pro9 Substance P 6 11 79775 19 2 Parathyroid Hormone 1 38 human 78232 94 7

Pmp1 Tyr OMe 2 Orn8 Vasotocin 77327 45 8 Pyr Val Lys Leu Tyr Arg Pro NH2 · HCl 763074 36 8 Pancreatic Polypeptide human 75976 10 2 Polistes Mastoparan 74129 19 4 Pancreatic Polypeptide 31 36 amide human 74012 13 8 Peptide 6A 73549 32 3 PYROGLU GLY ARG P NITROANILIDE 72194 52 6 Pyr Pro Arg pNA 72194 57 1 pTH 1 84 human 68893 82 3 Pmp1 Tyr OMe 2 Arg8 Vasopressin 67269 08 3 pTH 44 68 human 64421 69 8 p Aminophenylacetyl Tuftsin 63147 94 4 Pyr6 Substance P 6 11 61123 13 5 Pancreatic Polypeptide human APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY NH2 59763 91 6 PKA Substrate GRGLSLSR 57836 10 9 Pyr5 Substance P 5 11 56104 22 4 Pentagastrin 5534 95 2 Parathyroid Hormone 1 34 human SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF 52232 67 4 Phe1 Ser2 TRAP 6 374898 11 0 Protease Activated Receptor 4 PAR 4 Agonist amide AYPGKF NH2 352017 71 1 Proinsulin C peptide 55 89 human RREAEDLQVGQVELGGGPGAGSLQPLALEGSLQKR 33017 11 7 Pyr Gly Gly Leu Arg Trp NH2 328085 50 3 Pep2 SVKI 328944 75 8 PT 141 32780 32 8 pTH 73 84 human 321957 35 1 PAR 3 1 6 human 320347 28 2 Procathepsin B 36 50 rat 317331 26 3 Procathepsin B 26 50 rat 317331 27 4 Presenilin 1 331 349 Cys human mouse 317335 35 6 Preptin rat 315197 73 0