Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
Prolactin Releasing Peptide 1 31 human SRTHRHSMEIRTPDINPAWYASRGIRPVGRF NH2 235433 36 0 Polyphemusin II Derived Peptide 229030 20 0 PAR 4 1 6 human 225779 44 2 Phenylac Tyr1 D Arg2 p chloro Phe6 Arg9 Abu15 Nle27 D Arg28 Homoarg29 GRF 1 29 amide human 221377 59 9 Prolactin Releasing Peptide 12 31 rat TPDINPAWYTGRGIRPVGRF NH2 222988 10 5 PMX 53 AcF OPdChaWR AcF OPdChaWR AcF OP D Cha WR 219639 70 0 Parasin I 219552 69 9 Pyr1 Apelin 13 Pyr Arg Pro Arg Leu Ser His Lys Gly Pro Met Pro Phe OH 217082 60 5 Pompilidotoxin 216064 36 7 Prolactin Releasing Peptide 1 31 rat SRAHQHSMETRTPDINPAWYTGRGIRPVGRF NH2 215510 06 8 pTH 70 84 human 213533 86 9 PAR 4 1 6 mouse 213018 42 9 Pyr Phe OH 21282 12 2 Pyr Ala OH 21282 08 6 pTH Related Protein 1 37 human rat 206010 80 2 Pyr Phe Gly NH2 203396 25 2 PAR 2 1 6 human 202933 49 1 Prion Protein 118 135 human 202121 pp60C SRC Carboxy Terminal Phosphoregulatory Peptide TSTEPQYQPGENL 198754 34 6 Pyr Trp Leu Arg Gly Arg Phe NH2 · HCl 195208 21 0 Pramlintide Acetate 196078 30 5 Pancreatic Polypeptide 31 36 Free Acid human 192432 73 8 Pyr11 beta Amyloid 11 40 Pyr VHHQKLVFFAEDVGSNKGAIIGLMVGGVV 192377 94 9 Protease Activated Receptor 2 PAR 2 Agonist amide SLIGKV NH2 190383 13 2 Peptide 46 192122 40 0 Phe22 Big Endothelin 1 19 37 human 189064 07 1 Pyr3 beta Amyloid 3 42 Pyr FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA 183449 57 2 Pro18 Asp21 beta Amyloid 17 21 iAb5 LPFFD 182912 74 9 Pro34 Peptide YY human YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRPRY NH2 179986 93 7 Pancreatic Polypeptide bovine APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY NH2 179986 89 1