Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
PYX 1 140842 17 7 pTH Related Protein Splice Isoform 3 140 173 human 139872 85 8 Parathyroid Hormone Related Peptide 107 111 138949 73 2 PACAP 38 31 38 human chicken mouse ovine porcine rat 138764 85 9 PACAP 38 human mouse ovine porcine rat 137061 48 4 pTH 1 37 human 136799 54 7 pGlu16 VIP 16 28 porcine Pyr MAVKKYLNSILN NH2 134907 86 1 pTH Related Protein 67 86 amide human bovine dog mouse ovine rat 134981 49 0 Protein Kinase p34 cd2 Substrate ADAQHATPPKKKRKVEDPKDF ADAQHATPPKKKRKVEDPKDF 135546 44 0 Pancreastatin 37 52 Human EEEEEMAVVPQGLFRG NH2 133605 57 9 PyBrOP 132705 51 2 PACAP Related Peptide PRP rat DVAHEILNEAYRKVLDQLSARKYLQSMVA 132769 35 8 Pancreatic Polypeptide rana temporaria 132187 74 7 Peptide A Tyrosine Kinase Inhibitor VAPSDSIQAEEWYFGKITRRE 131023 24 0 Pneumadin human 130918 91 1 Pneumadin rat 130918 90 0 pTH 64 84 human 129449 07 6 Phenylac1 D Tyr Et 2 Lys6 Arg8 des Gly9 Vasopressin 129520 65 6 Pro34 Neuropeptide Y human rat YPSKPDNPGEDAPAEDMARYYSALRHYINLITRPRY NH2 128768 54 7 PyBOP 128625 52 5 PACAP 1 27 amide human ovine rat HSDGIFTDSYSRYRKQMAVKKYLAAVL NH2 127317 03 7 pTH Related Protein 1 16 human rat 126391 27 3 Parathyroid Hormone 1 34 bovine AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF 12583 68 5 pClPhe5 8 Bradykinin 125229 63 2 PACAP 1 38 amide human ovine rat HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK NH2 124123 15 5 Peptide YY 3 36 human IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY NH2 123583 37 9 PKC 530 558 LLYEMLAGQAPFEGEDEDELFQSIMEHNV NH2 122613 29 0 PRO ASP VAL ASP HIS VAL PHE LEU ARG PHE AMIDE 121801 61 4 PKI Inhibitor 6 22 amide TYADFIASGRTGRRNAI NH2 121932 06 7 PLP 139 151 HSLGKWLGHPDKF 122018 58 0