Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
PyBOP 128625 52 5 Pro34 Neuropeptide Y human rat YPSKPDNPGEDAPAEDMARYYSALRHYINLITRPRY NH2 128768 54 7 PACAP 1 27 amide human ovine rat HSDGIFTDSYSRYRKQMAVKKYLAAVL NH2 127317 03 7 pTH Related Protein 1 16 human rat 126391 27 3 Parathyroid Hormone 1 34 bovine AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF 12583 68 5 pClPhe5 8 Bradykinin 125229 63 2 PACAP 1 38 amide human ovine rat HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK NH2 124123 15 5 Peptide YY 3 36 human IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY NH2 123583 37 9 PKC 530 558 LLYEMLAGQAPFEGEDEDELFQSIMEHNV NH2 122613 29 0 PRO ASP VAL ASP HIS VAL PHE LEU ARG PHE AMIDE 121801 61 4 PKI Inhibitor 6 22 amide TYADFIASGRTGRRNAI NH2 121932 06 7 PLP 139 151 HSLGKWLGHPDKF 122018 58 0 Prepro TRH 178 199 122018 92 2 Protein Kinase C 19 31 121545 65 1 PKC Substrate Derived from EGF Receptor KRTLRR 121284 21 7 Propionyl1 D Tyr Et 2 Val4 Abu6 Arg8·9 Vasopressin 121250 95 1 P T P S NH2 121269 85 0 Pro7 Neurokinin B 120814 48 4 Pol RFamide 119116 89 1 Protein Kinase Related Peptides 119386 39 9 Peptide YY human YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY NH2 118997 30 1 Pyr1 Opiorphin 1189350 60 4 Phe4 Dermorphin 1 4 amide 118476 87 2 Palmitoyl Cys RS 2 3 di palmitoyloxy propyl Ala Gly OH 117858 54 5 PKC 19 36 PKC Selective Inhibitor Protein RFARKGALRQKNVHEVKN 113731 96 7 Pyr Gln OH 109481 23 4 Prepro VIP PHM 156 170 107902 86 3 Pancreastatin 33 49 porcine QEEEEETAGAPQGLFRG NH2 106507 61 3 Pancreastatin porcine GWPQAPAMDGAGKTGAEEAQPPEGKGAREHSRQEEEEETAGAPQGLFRG NH2 106477 83 2 PKC Substrate 2 VRKRTLRRL 105802 82 2