Browse Alphabetically:ABCDEFGHIJKLMNOPQRSTUVWXYZ0-9
pTH 1 37 human 136799 54 7 Protein Kinase p34 cd2 Substrate ADAQHATPPKKKRKVEDPKDF ADAQHATPPKKKRKVEDPKDF 135546 44 0 pTH Related Protein 67 86 amide human bovine dog mouse ovine rat 134981 49 0 pGlu16 VIP 16 28 porcine Pyr MAVKKYLNSILN NH2 134907 86 1 Pancreastatin 37 52 Human EEEEEMAVVPQGLFRG NH2 133605 57 9 PyBrOP 132705 51 2 PACAP Related Peptide PRP rat DVAHEILNEAYRKVLDQLSARKYLQSMVA 132769 35 8 Pancreatic Polypeptide rana temporaria 132187 74 7 Peptide A Tyrosine Kinase Inhibitor VAPSDSIQAEEWYFGKITRRE 131023 24 0 Pneumadin rat 130918 90 0 Pneumadin human 130918 91 1 Phenylac1 D Tyr Et 2 Lys6 Arg8 des Gly9 Vasopressin 129520 65 6 pTH 64 84 human 129449 07 6 PyBOP 128625 52 5 Pro34 Neuropeptide Y human rat YPSKPDNPGEDAPAEDMARYYSALRHYINLITRPRY NH2 128768 54 7 PACAP 1 27 amide human ovine rat HSDGIFTDSYSRYRKQMAVKKYLAAVL NH2 127317 03 7 pTH Related Protein 1 16 human rat 126391 27 3 Parathyroid Hormone 1 34 bovine AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNF 12583 68 5 pClPhe5 8 Bradykinin 125229 63 2 PACAP 1 38 amide human ovine rat HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK NH2 124123 15 5 Peptide YY 3 36 human IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY NH2 123583 37 9 PKC 530 558 LLYEMLAGQAPFEGEDEDELFQSIMEHNV NH2 122613 29 0 Prepro TRH 178 199 122018 92 2 PKI Inhibitor 6 22 amide TYADFIASGRTGRRNAI NH2 121932 06 7 PLP 139 151 HSLGKWLGHPDKF 122018 58 0 PRO ASP VAL ASP HIS VAL PHE LEU ARG PHE AMIDE 121801 61 4 Protein Kinase C 19 31 121545 65 1 PKC Substrate Derived from EGF Receptor KRTLRR 121284 21 7 P T P S NH2 121269 85 0 Propionyl1 D Tyr Et 2 Val4 Abu6 Arg8·9 Vasopressin 121250 95 1